Overview
Sequence
The following sequences are available for this feature:
polypeptide sequence >TCONS_00006930-protein ID=TCONS_00006930-protein|Name=TCONS_00006930-protein|organism=Clytia hemisphaerica|type=polypeptide|length=121bpRun BLAST on NCBI Gene-mRNA-Prot
This polypeptide comes from the following gene feature:
Annotated Terms
The following terms have been associated with this polypeptide:
GO Annotation
GO Assignments
This polypeptide is annotated with the following GO terms.
InterPro
Analysis Name: InterPro Annotations of C. hemisphaerica v1.0
Date Performed: 2017-06-01
Blast
BLAST of TCONS_00006930-protein vs. Swiss-Prot (Human)
Match: DPOE4 (DNA polymerase epsilon subunit 4 OS=Homo sapiens GN=POLE4 PE=1 SV=2) HSP 1 Score: 80.4925 bits (197), Expect = 7.822e-21 Identity = 35/79 (44.30%), Postives = 55/79 (69.62%), Query Frame = 0 Query: 43 NKFPTTRIRALMRMDSDLNIASQESVYLISKATEYFVQYQAKEAYKKTAASKRKTVQKRDLDAAITECDGMAFLEGAID 121 ++ P R++AL++ D D+ +A QE+++++++A E FV+ AK+AY KRKT+Q+RDLD AI D AFLEG +D Sbjct: 39 SRLPLARVKALVKADPDVTLAGQEAIFILARAAELFVETIAKDAYCCAQQGKRKTLQRRDLDNAIEAVDEFAFLEGTLD 117 The following BLAST results are available for this feature:
BLAST of TCONS_00006930-protein vs. Swiss-Prot (Human)
Analysis Date: 2018-01-31 (Blastp Clytia hemisphaerica v1.0 proteins vs SwissProt (Homo sapiens)) Total hits: 1
|