Overview
Sequence
The following sequences are available for this feature:
polypeptide sequence >TCONS_00008289-protein ID=TCONS_00008289-protein|Name=TCONS_00008289-protein|organism=Clytia hemisphaerica|type=polypeptide|length=282bpRun BLAST on NCBI Gene-mRNA-Prot
This polypeptide comes from the following gene feature:
InterPro
Analysis Name: InterPro Annotations of C. hemisphaerica v1.0
Date Performed: 2017-06-01
Blast
BLAST of TCONS_00008289-protein vs. Swiss-Prot (Human)
Match: DBR1 (Lariat debranching enzyme OS=Homo sapiens GN=DBR1 PE=1 SV=2) HSP 1 Score: 99.7525 bits (247), Expect = 1.306e-23 Identity = 41/73 (56.16%), Postives = 54/73 (73.97%), Query Frame = 0 Query: 1 MKIAIEGCAHGELNKIYESIQYIQGREKIKIDLLICCGDFQSVRNKDDMLSMAVPPKYREMKDFPDYYSDEMK 73 M++A+ GC HGEL+KIYE++ + R +DLL+CCGDFQ+VRN+ D+ MAVPPKYR M+ F YYS E K Sbjct: 1 MRVAVAGCCHGELDKIYETLALAERRGPGPVDLLLCCGDFQAVRNEADLRCMAVPPKYRHMQTFYRYYSGEKK 73 The following BLAST results are available for this feature:
BLAST of TCONS_00008289-protein vs. Swiss-Prot (Human)
Analysis Date: 2018-01-31 (Blastp Clytia hemisphaerica v1.0 proteins vs SwissProt (Homo sapiens)) Total hits: 1
|