Overview
Sequence
The following sequences are available for this feature:
polypeptide sequence >TCONS_00009617-protein ID=TCONS_00009617-protein|Name=TCONS_00009617-protein|organism=Clytia hemisphaerica|type=polypeptide|length=136bpRun BLAST on NCBI Gene-mRNA-Prot
This polypeptide comes from the following gene feature:
InterPro
Analysis Name: InterPro Annotations of C. hemisphaerica v1.0
Date Performed: 2017-06-01
Blast
BLAST of TCONS_00009617-protein vs. Swiss-Prot (Human)
Match: TRPM2 (Transient receptor potential cation channel subfamily M member 2 OS=Homo sapiens GN=TRPM2 PE=1 SV=2) HSP 1 Score: 85.1149 bits (209), Expect = 3.047e-20 Identity = 40/75 (53.33%), Postives = 54/75 (72.00%), Query Frame = 0 Query: 62 TNSFGECHFLGATRKAKGKFIRIAHDTSMEDTFSLLTEHWKIDEPQLLISVTGGAKSFNMDPRLKQQFASGLVKV 136 T++FG+ F G ++K K K++R++ DT + L+T+HW +D P LLISVTGGAK+FNM PRLK F GLVKV Sbjct: 124 TDAFGDIVFTGLSQKVK-KYVRVSQDTPSSVIYHLMTQHWGLDVPNLLISVTGGAKNFNMKPRLKSIFRRGLVKV 197 The following BLAST results are available for this feature:
BLAST of TCONS_00009617-protein vs. Swiss-Prot (Human)
Analysis Date: 2018-01-31 (Blastp Clytia hemisphaerica v1.0 proteins vs SwissProt (Homo sapiens)) Total hits: 1
|