Overview
Sequence
The following sequences are available for this feature:
polypeptide sequence >TCONS_00011659-protein ID=TCONS_00011659-protein|Name=TCONS_00011659-protein|organism=Clytia hemisphaerica|type=polypeptide|length=197bpRun BLAST on NCBI Gene-mRNA-Prot
This polypeptide comes from the following gene feature:
Annotated Terms
The following terms have been associated with this polypeptide:
InterPro
Analysis Name: InterPro Annotations of C. hemisphaerica v1.0
Date Performed: 2017-06-01
Blast
BLAST of TCONS_00011659-protein vs. Swiss-Prot (Human)
Match: BORC6 (BLOC-1-related complex subunit 6 OS=Homo sapiens GN=BORCS6 PE=1 SV=2) HSP 1 Score: 84.7297 bits (208), Expect = 1.163e-19 Identity = 39/102 (38.24%), Postives = 63/102 (61.76%), Query Frame = 0 Query: 96 VDPMVLPEIEEQAKIASKSIDRLMKFLSKELTEGTKATTDIVSVYDGTIDHVHSEVEQNIKAMYGLIAKCEELDRKMKPINELASQVRNIRETLDQLENICK 197 +DP VL ++E ++ +DRL++ L + E T + + Y +D + V+ +IK MY L+A+CEEL+R ++P+ LA QVR+IR TL+ LE +CK Sbjct: 256 IDPEVLRDLERLSRELGGRVDRLLRGLGGAVQELTALSVGCIQTYRDAVDSLGEAVDMSIKGMYTLLARCEELERALQPVQGLARQVRDIRRTLEVLEALCK 357 The following BLAST results are available for this feature:
BLAST of TCONS_00011659-protein vs. Swiss-Prot (Human)
Analysis Date: 2018-01-31 (Blastp Clytia hemisphaerica v1.0 proteins vs SwissProt (Homo sapiens)) Total hits: 1
|