Overview
Sequence
The following sequences are available for this feature:
polypeptide sequence >TCONS_00012885-protein ID=TCONS_00012885-protein|Name=TCONS_00012885-protein|organism=Clytia hemisphaerica|type=polypeptide|length=130bpRun BLAST on NCBI Gene-mRNA-Prot
This polypeptide comes from the following gene feature:
Annotated Terms
The following terms have been associated with this polypeptide:
GO Annotation
GO Assignments
This polypeptide is annotated with the following GO terms.
InterPro
Analysis Name: InterPro Annotations of C. hemisphaerica v1.0
Date Performed: 2017-06-01
Blast
BLAST of TCONS_00012885-protein vs. Swiss-Prot (Human)
Match: MELK (Maternal embryonic leucine zipper kinase OS=Homo sapiens GN=MELK PE=1 SV=3) HSP 1 Score: 103.219 bits (256), Expect = 9.616e-27 Identity = 56/103 (54.37%), Postives = 71/103 (68.93%), Query Frame = 0 Query: 13 ELDAYIDLSEKLGEGGFAEVHLAEHRPTGMKVAIKVMSKANLKSMGDLHRAYREIDAMKRLGSHQHVCQLYQVVENDENIYLVLEHISGGELFDYIVSREKLS 115 EL Y +L E +G GGFA+V LA H TG VAIK+M K L S DL R EI+A+K L HQH+CQLY V+E I++VLE+ GGELFDYI+S+++LS Sbjct: 6 ELLKYYELHETIGTGGFAKVKLACHILTGEMVAIKIMDKNTLGS--DLPRIKTEIEALKNL-RHQHICQLYHVLETANKIFMVLEYCPGGELFDYIISQDRLS 105 The following BLAST results are available for this feature:
BLAST of TCONS_00012885-protein vs. Swiss-Prot (Human)
Analysis Date: 2018-01-31 (Blastp Clytia hemisphaerica v1.0 proteins vs SwissProt (Homo sapiens)) Total hits: 1
|