Overview
Sequence
The following sequences are available for this feature:
polypeptide sequence >TCONS_00014543-protein ID=TCONS_00014543-protein|Name=TCONS_00014543-protein|organism=Clytia hemisphaerica|type=polypeptide|length=100bpRun BLAST on NCBI Gene-mRNA-Prot
This polypeptide comes from the following gene feature:
Annotated Terms
The following terms have been associated with this polypeptide:
InterPro
Analysis Name: InterPro Annotations of C. hemisphaerica v1.0
Date Performed: 2017-06-01
Blast
BLAST of TCONS_00014543-protein vs. Swiss-Prot (Human)
Match: CCD58 (Coiled-coil domain-containing protein 58 OS=Homo sapiens GN=CCDC58 PE=1 SV=1) HSP 1 Score: 75.485 bits (184), Expect = 7.639e-19 Identity = 41/93 (44.09%), Postives = 65/93 (69.89%), Query Frame = 0 Query: 9 TCENLRHFKLLSYYKAREEGINSCINQKTDRIEKLREQIETN-EDATLMRELRNEQSKLRVMKSELLVEDVVKARSLKIFNERCWKAYTPPQS 100 TC+ L + L++ + +R+ I +CI Q + ++ LRE+ E N +D TL+++LR EQ+KL+ M+SEL VE+VV RS K+FNERC + PP++ Sbjct: 52 TCKQL-YESLMAAHASRDRVIKNCIAQTSAVVKNLREEREKNLDDLTLLKQLRKEQTKLKWMQSELNVEEVVNDRSWKVFNERCRIHFKPPKN 143 The following BLAST results are available for this feature:
BLAST of TCONS_00014543-protein vs. Swiss-Prot (Human)
Analysis Date: 2018-01-31 (Blastp Clytia hemisphaerica v1.0 proteins vs SwissProt (Homo sapiens)) Total hits: 1
|