Overview
Sequence
The following sequences are available for this feature:
polypeptide sequence >TCONS_00016646-protein ID=TCONS_00016646-protein|Name=TCONS_00016646-protein|organism=Clytia hemisphaerica|type=polypeptide|length=262bpRun BLAST on NCBI Gene-mRNA-Prot
This polypeptide comes from the following gene feature:
Annotated Terms
The following terms have been associated with this polypeptide:
GO Annotation
GO Assignments
This polypeptide is annotated with the following GO terms.
InterPro
Analysis Name: InterPro Annotations of C. hemisphaerica v1.0
Date Performed: 2017-06-01
Blast
BLAST of TCONS_00016646-protein vs. Swiss-Prot (Human)
Match: CIRBP (Cold-inducible RNA-binding protein OS=Homo sapiens GN=CIRBP PE=1 SV=1) HSP 1 Score: 78.5666 bits (192), Expect = 5.622e-18 Identity = 44/97 (45.36%), Postives = 58/97 (59.79%), Query Frame = 0 Query: 45 TDEGRIKLYVGSLPFDTRGPDLHEMFSKYGNCSNANVVMEREDETRSRGFGFVEFDTLDEATAAIEGLNETKLGHRNIMVQHAGKPASGKPPQRRGG 141 +DEG KL+VG L FDT L ++FSKYG S VV +RE + RSRGFGFV F+ +D+A A+ +N + R I V AGK + + RGG Sbjct: 3 SDEG--KLFVGGLSFDTNEQSLEQVFSKYGQISEVVVVKDRETQ-RSRGFGFVTFENIDDAKDAMMAMNGKSVDGRQIRVDQAGKSSDNRSRGYRGG 96 The following BLAST results are available for this feature:
BLAST of TCONS_00016646-protein vs. Swiss-Prot (Human)
Analysis Date: 2018-01-31 (Blastp Clytia hemisphaerica v1.0 proteins vs SwissProt (Homo sapiens)) Total hits: 1
|