Overview
Sequence
The following sequences are available for this feature:
polypeptide sequence >TCONS_00023296-protein ID=TCONS_00023296-protein|Name=TCONS_00023296-protein|organism=Clytia hemisphaerica|type=polypeptide|length=697bpRun BLAST on NCBI Gene-mRNA-Prot
This polypeptide comes from the following gene feature:
Annotated Terms
The following terms have been associated with this polypeptide:
InterPro
Analysis Name: InterPro Annotations of C. hemisphaerica v1.0
Date Performed: 2017-06-01
Blast
BLAST of TCONS_00023296-protein vs. Swiss-Prot (Human)
Match: TAF3 (Transcription initiation factor TFIID subunit 3 OS=Homo sapiens GN=TAF3 PE=1 SV=1) HSP 1 Score: 112.079 bits (279), Expect = 1.896e-25 Identity = 36/52 (69.23%), Postives = 42/52 (80.77%), Query Frame = 0 Query: 629 YDNKIYYCPGCGKPDDGSPMIGCDKCDDWYHWPCVNIVEEPAEDEKWFCPNC 680 + N+I+ CPGC KPDDGSPMIGCD CDDWYHWPCV I+ P E+ +WFCP C Sbjct: 861 WGNQIWICPGCNKPDDGSPMIGCDDCDDWYHWPCVGIMTAPPEEMQWFCPKC 912 The following BLAST results are available for this feature:
BLAST of TCONS_00023296-protein vs. Swiss-Prot (Human)
Analysis Date: 2018-01-31 (Blastp Clytia hemisphaerica v1.0 proteins vs SwissProt (Homo sapiens)) Total hits: 1
|