Overview
Sequence
The following sequences are available for this feature:
polypeptide sequence >TCONS_00023447-protein ID=TCONS_00023447-protein|Name=TCONS_00023447-protein|organism=Clytia hemisphaerica|type=polypeptide|length=220bpRun BLAST on NCBI Gene-mRNA-Prot
This polypeptide comes from the following gene feature:
Annotated Terms
The following terms have been associated with this polypeptide:
GO Annotation
GO Assignments
This polypeptide is annotated with the following GO terms.
InterPro
Analysis Name: InterPro Annotations of C. hemisphaerica v1.0
Date Performed: 2017-06-01
Blast
BLAST of TCONS_00023447-protein vs. Swiss-Prot (Human)
Match: UNC4 (Homeobox protein unc-4 homolog OS=Homo sapiens GN=UNCX PE=3 SV=1) HSP 1 Score: 81.2629 bits (199), Expect = 7.801e-18 Identity = 39/91 (42.86%), Postives = 59/91 (64.84%), Query Frame = 0 Query: 39 SGDDQSFRESSTEESLENLDDASCG---KKTRQCFTSKQVEELERLFNETNYPDAYTRQMLAKRMNVSETRIQIWCQNRRAKLRRQRKQRK 126 GD Q F+ S + + D S G ++TR FT Q+EELE+ FNE++YPD + R+ LA R+++ E+R+Q+W QNRRAK R++ +K Sbjct: 82 GGDGQPFKLSDSGDP----DKESPGCKRRRTRTNFTGWQLEELEKAFNESHYPDVFMREALALRLDLVESRVQVWFQNRRAKWRKKENTKK 168 The following BLAST results are available for this feature:
BLAST of TCONS_00023447-protein vs. Swiss-Prot (Human)
Analysis Date: 2018-01-31 (Blastp Clytia hemisphaerica v1.0 proteins vs SwissProt (Homo sapiens)) Total hits: 1
|