Overview
Sequence
The following sequences are available for this feature:
polypeptide sequence >TCONS_00044651-protein ID=TCONS_00044651-protein|Name=TCONS_00044651-protein|organism=Clytia hemisphaerica|type=polypeptide|length=142bpRun BLAST on NCBI Gene-mRNA-Prot
This polypeptide comes from the following gene feature:
Annotated Terms
The following terms have been associated with this polypeptide:
InterPro
Analysis Name: InterPro Annotations of C. hemisphaerica v1.0
Date Performed: 2017-06-01
Blast
BLAST of TCONS_00044651-protein vs. Swiss-Prot (Human)
Match: MROH1 (Maestro heat-like repeat-containing protein family member 1 OS=Homo sapiens GN=MROH1 PE=2 SV=3) HSP 1 Score: 81.6481 bits (200), Expect = 7.018e-19 Identity = 42/137 (30.66%), Postives = 72/137 (52.55%), Query Frame = 0 Query: 1 MSSTANHERERSVLSIKDLLEHYLKMANFNNEMHFSTLGYILGRLLPRCTDPMTDVRQTTMECVQLLLTINDRYEGVPSNVSDERIQGLTQLRDALSKSDPAALFNVVNELSLVVSKKTPDEQLKTLVFSLTDGLND 137 + S HER R++ LL ++L+ + + F LG ++G PRC D RQ ++CV LL + YEG + D+ + L L+D L DPA LF+ + + +++K+ P +QL +L+ ++ + L D Sbjct: 928 IKSPRGHERARALGLSALLLRYFLEHLRVSALVPFHNLGLLIGLFSPRCADLWPATRQEAVDCVYSLLYLQLGYEGFSRDYRDDVAERLLSLKDGLVHPDPAILFHTCHSVGQIIAKRLPPDQLISLLLTMFEALGD 1064 The following BLAST results are available for this feature:
BLAST of TCONS_00044651-protein vs. Swiss-Prot (Human)
Analysis Date: 2018-01-31 (Blastp Clytia hemisphaerica v1.0 proteins vs SwissProt (Homo sapiens)) Total hits: 1
|