Overview
Sequence
The following sequences are available for this feature:
polypeptide sequence >TCONS_00044890-protein ID=TCONS_00044890-protein|Name=TCONS_00044890-protein|organism=Clytia hemisphaerica|type=polypeptide|length=103bpRun BLAST on NCBI Gene-mRNA-Prot
This polypeptide comes from the following gene feature:
Annotated Terms
The following terms have been associated with this polypeptide:
GO Annotation
GO Assignments
This polypeptide is annotated with the following GO terms.
InterPro
Analysis Name: InterPro Annotations of C. hemisphaerica v1.0
Date Performed: 2017-06-01
Blast
BLAST of TCONS_00044890-protein vs. Swiss-Prot (Human)
Match: KCRS (Creatine kinase S-type, mitochondrial OS=Homo sapiens GN=CKMT2 PE=1 SV=2) HSP 1 Score: 95.9005 bits (237), Expect = 8.251e-25 Identity = 43/83 (51.81%), Postives = 55/83 (66.27%), Query Frame = 0 Query: 21 AALGLAAGAMGFPEAANDCKSTVKKAYRQFMPCIDYPDLSKHNNCLSKVLTPQMYAKLRDLQTPSGYTLDMAIQTGVDNPGHP 103 A +G + G+ + V++ R F P DYPDL KHNNC+++ LTP +YAKLR+ TP+GYTLD IQTGVDNPGHP Sbjct: 19 ATMGTSVLTTGYLLNRQKVCAEVREQPRLFPPSADYPDLRKHNNCMAECLTPAIYAKLRNKVTPNGYTLDQCIQTGVDNPGHP 101 The following BLAST results are available for this feature:
BLAST of TCONS_00044890-protein vs. Swiss-Prot (Human)
Analysis Date: 2018-01-31 (Blastp Clytia hemisphaerica v1.0 proteins vs SwissProt (Homo sapiens)) Total hits: 1
|