Overview
Sequence
The following sequences are available for this feature:
polypeptide sequence >TCONS_00055215-protein ID=TCONS_00055215-protein|Name=TCONS_00055215-protein|organism=Clytia hemisphaerica|type=polypeptide|length=244bpRun BLAST on NCBI Gene-mRNA-Prot
This polypeptide comes from the following gene feature:
Annotated Terms
The following terms have been associated with this polypeptide:
GO Annotation
GO Assignments
This polypeptide is annotated with the following GO terms.
InterPro
Analysis Name: InterPro Annotations of C. hemisphaerica v1.0
Date Performed: 2017-06-01
Blast
BLAST of TCONS_00055215-protein vs. Swiss-Prot (Human)
Match: FAT4 (Protocadherin Fat 4 OS=Homo sapiens GN=FAT4 PE=1 SV=2) HSP 1 Score: 80.8777 bits (198), Expect = 2.033e-17 Identity = 40/100 (40.00%), Postives = 52/100 (52.00%), Query Frame = 0 Query: 139 RPGVCTCKSGYNGNRCKKDIDECLRKPCEQ--TCKNLPGTYACSCRAGYKKINNDSKSRQCV-NVEECLTTPCKCAQPKNCKATCTDTTGSFKCSCNKGF 235 +P +C C GY G+ C+ DIDECL PC TC NL G ++CSC G+ R C ++ ECL +PCK A C + GSF C C G+ Sbjct: 3844 QPFLCKCLPGYAGSWCEIDIDECLPSPCHSGGTCHNLVGGFSCSCPDGF-------TGRACERDINECLQSPCKNG------AICQNFPGSFNCVCKTGY 3930 The following BLAST results are available for this feature:
BLAST of TCONS_00055215-protein vs. Swiss-Prot (Human)
Analysis Date: 2018-01-31 (Blastp Clytia hemisphaerica v1.0 proteins vs SwissProt (Homo sapiens)) Total hits: 1
|