Overview
Sequence
The following sequences are available for this feature:
polypeptide sequence >TCONS_00065427-protein ID=TCONS_00065427-protein|Name=TCONS_00065427-protein|organism=Clytia hemisphaerica|type=polypeptide|length=365bpRun BLAST on NCBI Gene-mRNA-Prot
This polypeptide comes from the following gene feature:
Annotated Terms
The following terms have been associated with this polypeptide:
GO Annotation
GO Assignments
This polypeptide is annotated with the following GO terms.
InterPro
Analysis Name: InterPro Annotations of C. hemisphaerica v1.0
Date Performed: 2017-06-01
Blast
BLAST of TCONS_00065427-protein vs. Swiss-Prot (Human)
Match: DMTA2 (Doublesex- and mab-3-related transcription factor A2 OS=Homo sapiens GN=DMRTA2 PE=2 SV=2) HSP 1 Score: 122.865 bits (307), Expect = 6.819e-31 Identity = 54/72 (75.00%), Postives = 62/72 (86.11%), Query Frame = 0 Query: 21 PRAPKCARCRNHGVVSWLKGHKRFCKWKDCPCSKCVLITERQRVMAAQVALRRQQAQEENNQDAKLKINYKS 92 PR PKCARCRNHGVVS LKGHKR+C+WKDC C+KC LI ERQRVMAAQVALRRQQAQEE N+ +L++ Y + Sbjct: 65 PRTPKCARCRNHGVVSALKGHKRYCRWKDCLCAKCTLIAERQRVMAAQVALRRQQAQEE-NEARELQLLYGT 135 The following BLAST results are available for this feature:
BLAST of TCONS_00065427-protein vs. Swiss-Prot (Human)
Analysis Date: 2018-01-31 (Blastp Clytia hemisphaerica v1.0 proteins vs SwissProt (Homo sapiens)) Total hits: 1
|