Overview
Sequence
The following sequences are available for this feature:
polypeptide sequence >TCONS_00067347-protein ID=TCONS_00067347-protein|Name=TCONS_00067347-protein|organism=Clytia hemisphaerica|type=polypeptide|length=577bpRun BLAST on NCBI Gene-mRNA-Prot
This polypeptide comes from the following gene feature:
Annotated Terms
The following terms have been associated with this polypeptide:
InterPro
Analysis Name: InterPro Annotations of C. hemisphaerica v1.0
Date Performed: 2017-06-01
Blast
BLAST of TCONS_00067347-protein vs. Swiss-Prot (Human)
Match: RNF38 (E3 ubiquitin-protein ligase RNF38 OS=Homo sapiens GN=RNF38 PE=1 SV=4) HSP 1 Score: 128.642 bits (322), Expect = 9.548e-32 Identity = 52/90 (57.78%), Postives = 71/90 (78.89%), Query Frame = 0 Query: 482 ENYEALLNLADTLGPGKPRGLDKTEIERIPSFRFSSNTAKETNVKCVVCISEYTNREKLRRLPCSHDFHAKCIDKWLKSNKTCPVCRDEV 571 ENYEALLNLA+ LG KPRGL K +IE++PS+RF+ N + CVVC+ ++ +R+ LR LPC+H+FHAKC+DKWLK+N+TCP+CR + Sbjct: 418 ENYEALLNLAERLGEAKPRGLTKADIEQLPSYRFNPNNHQSEQTLCVVCMCDFESRQLLRVLPCNHEFHAKCVDKWLKANRTCPICRADA 507 The following BLAST results are available for this feature:
BLAST of TCONS_00067347-protein vs. Swiss-Prot (Human)
Analysis Date: 2018-01-31 (Blastp Clytia hemisphaerica v1.0 proteins vs SwissProt (Homo sapiens)) Total hits: 1
|