Overview
Sequence
The following sequences are available for this feature:
polypeptide sequence >TCONS_00070453-protein ID=TCONS_00070453-protein|Name=Sox15 protein|organism=Clytia hemisphaerica|type=polypeptide|length=345bpRun BLAST on NCBI Gene-mRNA-Prot
This polypeptide comes from the following gene feature:
Annotated Terms
The following terms have been associated with this polypeptide:
InterPro
Analysis Name: InterPro Annotations of C. hemisphaerica v1.0
Date Performed: 2017-06-01
Blast
BLAST of Sox15 protein vs. Swiss-Prot (Human)
Match: SOX14 (Transcription factor SOX-14 OS=Homo sapiens GN=SOX14 PE=1 SV=1) HSP 1 Score: 103.219 bits (256), Expect = 7.602e-26 Identity = 42/77 (54.55%), Postives = 66/77 (85.71%), Query Frame = 0 Query: 71 SDKIKRPMNAFMLWSKLRRREISKNDPTIHNAQISKLLGEEWKVLSTEDKQPFLRESQKLMAKHKKEHPNYRYKPRK 147 SD IKRPMNAFM+WS+ +RR++++ +P +HN++ISK LG EWK+LS +K+P++ E+++L A+H KEHP+Y+Y+PR+ Sbjct: 5 SDHIKRPMNAFMVWSRGQRRKMAQENPKMHNSEISKRLGAEWKLLSEAEKRPYIDEAKRLRAQHMKEHPDYKYRPRR 81 The following BLAST results are available for this feature:
BLAST of Sox15 protein vs. Swiss-Prot (Human)
Analysis Date: 2018-01-31 (Blastp Clytia hemisphaerica v1.0 proteins vs SwissProt (Homo sapiens)) Total hits: 1
|