Overview
Sequence
The following sequences are available for this feature:
polypeptide sequence >TCONS_00070817-protein ID=TCONS_00070817-protein|Name=TCONS_00070817-protein|organism=Clytia hemisphaerica|type=polypeptide|length=168bpRun BLAST on NCBI Gene-mRNA-Prot
This polypeptide comes from the following gene feature:
Annotated Terms
The following terms have been associated with this polypeptide:
InterPro
Analysis Name: InterPro Annotations of C. hemisphaerica v1.0
Date Performed: 2017-06-01
Blast
BLAST of TCONS_00070817-protein vs. Swiss-Prot (Human)
Match: LMO4 (LIM domain transcription factor LMO4 OS=Homo sapiens GN=LMO4 PE=1 SV=1) HSP 1 Score: 89.7373 bits (221), Expect = 3.705e-23 Identity = 43/106 (40.57%), Postives = 59/106 (55.66%), Query Frame = 0 Query: 39 KCYGCKKRIRSRFYVDFMGSPWHENCLRCDVCEEILFSFGSGKCYCRDGQKLCLMDYIKLYGKTGTCSRCKLVISPTEKVMKCKGFTYHQQCFHCSICKRYFDKGE 144 +C GC +I RF + M S WH CL+C C+ L G+ CY + G LC DYI+L+G +G CS C I +E VM+ +G YH +CF CS C+ G+ Sbjct: 22 RCAGCGGKIADRFLLYAMDSYWHSRCLKCSCCQAQLGDIGT-SCYTKSGMILCRNDYIRLFGNSGACSACGQSIPASELVMRAQGNVYHLKCFTCSTCRNRLVPGD 126 The following BLAST results are available for this feature:
BLAST of TCONS_00070817-protein vs. Swiss-Prot (Human)
Analysis Date: 2018-01-31 (Blastp Clytia hemisphaerica v1.0 proteins vs SwissProt (Homo sapiens)) Total hits: 1
|