Overview
Sequence
The following sequences are available for this feature:
polypeptide sequence >TCONS_00071932-protein ID=TCONS_00071932-protein|Name=TCONS_00071932-protein|organism=Clytia hemisphaerica|type=polypeptide|length=203bpRun BLAST on NCBI Gene-mRNA-Prot
This polypeptide comes from the following gene feature:
Annotated Terms
The following terms have been associated with this polypeptide:
GO Annotation
GO Assignments
This polypeptide is annotated with the following GO terms.
InterPro
Analysis Name: InterPro Annotations of C. hemisphaerica v1.0
Date Performed: 2017-06-01
Blast
BLAST of TCONS_00071932-protein vs. Swiss-Prot (Human)
Match: VAX1 (Ventral anterior homeobox 1 OS=Homo sapiens GN=VAX1 PE=1 SV=1) HSP 1 Score: 82.0333 bits (201), Expect = 1.199e-18 Identity = 39/57 (68.42%), Postives = 45/57 (78.95%), Query Frame = 0 Query: 132 KRRRTIFTSSQLERLEFEFQQQQYIVGQERRFLARQLGLNEIQVKVWFQNRRIKWRK 188 KR RT FT+ QL RLE EFQ+ QY+VG+ER LARQL L+E QVKVWFQNRR K +K Sbjct: 101 KRTRTSFTAEQLYRLEMEFQRCQYVVGRERTELARQLNLSETQVKVWFQNRRTKQKK 157 The following BLAST results are available for this feature:
BLAST of TCONS_00071932-protein vs. Swiss-Prot (Human)
Analysis Date: 2018-01-31 (Blastp Clytia hemisphaerica v1.0 proteins vs SwissProt (Homo sapiens)) Total hits: 1
|