Overview
Sequence
The following sequences are available for this feature:
polypeptide sequence >TCONS_00072166-protein ID=TCONS_00072166-protein|Name=TCONS_00072166-protein|organism=Clytia hemisphaerica|type=polypeptide|length=508bpRun BLAST on NCBI Gene-mRNA-Prot
This polypeptide comes from the following gene feature:
Annotated Terms
The following terms have been associated with this polypeptide:
InterPro
Analysis Name: InterPro Annotations of C. hemisphaerica v1.0
Date Performed: 2017-06-01
Blast
BLAST of TCONS_00072166-protein vs. Swiss-Prot (Human)
Match: CLC4K (C-type lectin domain family 4 member K OS=Homo sapiens GN=CD207 PE=1 SV=2) HSP 1 Score: 79.7221 bits (195), Expect = 2.334e-16 Identity = 45/123 (36.59%), Postives = 66/123 (53.66%), Query Frame = 0 Query: 28 FNGVRYYFSPTPLSWQNAEIDCINRGGHLTSVHSKAENDFLTDQSISRFGGVSLWYGGIR--INNVFTWSDRTPF----TTTFWALGEPNGP-HVENCLHMTADHIGQWNDLRCIPELRYVCK 143 F G YYFS P +W +AE C++R HLTSV S++E +FL + GG+ W G + + ++W D TPF + FW GEPN + E+C ++ A + WND C ++CK Sbjct: 202 FKGNFYYFSLIPKTWYSAEQFCVSRNSHLTSVTSESEQEFLYKTA----GGLIYWIGLTKAGMEGDWSWVDDTPFNKVQSVRFWIPGEPNNAGNNEHCGNIKAPSLQAWNDAPCDKTFLFICK 320 The following BLAST results are available for this feature:
BLAST of TCONS_00072166-protein vs. Swiss-Prot (Human)
Analysis Date: 2018-01-31 (Blastp Clytia hemisphaerica v1.0 proteins vs SwissProt (Homo sapiens)) Total hits: 1
|