Overview
Sequence
The following sequences are available for this feature:
polypeptide sequence >TCONS_00072190-protein ID=TCONS_00072190-protein|Name=TCONS_00072190-protein|organism=Clytia hemisphaerica|type=polypeptide|length=146bpRun BLAST on NCBI Gene-mRNA-Prot
This polypeptide comes from the following gene feature:
Annotated Terms
The following terms have been associated with this polypeptide:
InterPro
Analysis Name: InterPro Annotations of C. hemisphaerica v1.0
Date Performed: 2017-06-01
Blast
BLAST of TCONS_00072190-protein vs. Swiss-Prot (Human)
Match: KXDL1 (KxDL motif-containing protein 1 OS=Homo sapiens GN=KXD1 PE=1 SV=2) HSP 1 Score: 75.485 bits (184), Expect = 6.700e-18 Identity = 38/77 (49.35%), Postives = 53/77 (68.83%), Query Frame = 0 Query: 18 DVTPIIKAQKSTLLRYEEINEMLRQFLELSNNTQSMLLENYIAHTKTLIELKKDLEISFRRIRALKTKLNVEYPDAF 94 DV II AQK+ L R+E+ NEML F LS+ + E ++ HT+TL+E+K+DL+ FRRIR LK KL ++P+AF Sbjct: 23 DVNAIILAQKNMLDRFEKTNEMLLNFNNLSSARLQQMSERFLHHTRTLVEMKRDLDSIFRRIRTLKGKLARQHPEAF 99 The following BLAST results are available for this feature:
BLAST of TCONS_00072190-protein vs. Swiss-Prot (Human)
Analysis Date: 2018-01-31 (Blastp Clytia hemisphaerica v1.0 proteins vs SwissProt (Homo sapiens)) Total hits: 1
|