Overview
Sequence
The following sequences are available for this feature:
transcript sequence >TCONS_00007899 ID=TCONS_00007899|Name=TCONS_00007899|organism=Clytia hemisphaerica|type=transcript|length=1426bpRun BLAST on NCBI transcript from alignment at sc0000080:295415..319214- Legend: exon Hold the cursor over a type above to highlight its positions in the sequence below.>TCONS_00007899 ID=TCONS_00007899|Name=TCONS_00007899|organism=Clytia hemisphaerica|type=transcript|length=23800bp|location=Sequence derived from alignment at sc0000080:295415..319214- (Clytia hemisphaerica) Gene-mRNA-Prot
This transcript is a part of the following gene feature(s):
Position
The following features are aligned
Expression
Hover the mouse over a column in the graph to view expression values in transcripts per million (tpm).
Values :
GrOo_1 GrOo_2 FGOo_1 FGOo_2 EG_1 EG_2 P1_1 P1_2 P2_1 P2_2 P3_1 P3_2 PoPr_1 PoPr_2 St_1 St_2 GO_1 GO_2 PH_1 PH_2 BMF_1 BMF_2 MMF_1 MMF_2 M_1 M_2 GEC_1 GEC_2 GEN_1 GEN_2 Blast
BLAST of TCONS_00007899 vs. Swiss-Prot (Human)
Match: ASTL (Astacin-like metalloendopeptidase OS=Homo sapiens GN=ASTL PE=1 SV=4) HSP 1 Score: 93.5893 bits (231), Expect = 1.533e-20 Identity = 47/111 (42.34%), Postives = 70/111 (63.06%), Query Frame = 1 Query: 1102 VPYEIDSALAE-SQTTIITALKEIEAKTCVRFVSRSSDEKNWIKFVKKSGCWSSVGRKFWVDGYQELSLGDGCIY--HGIIMHEVMHALGFYHEQSRSDRDQYVEIFWENI 1425 VP+ + S E S+ I+ AL E E TC+RFV+ D++++I + GC+SSVGR G Q +SL C+ GI++HE+MH LGF+HE +R+DRD+Y+ + W I Sbjct: 104 VPFLLSSKYDEPSRQVILEALAEFERSTCIRFVTYQ-DQRDFISIIPMYGCFSSVGRS---GGMQVVSLAPTCLQKGRGIVLHELMHVLGFWHEHTRADRDRYIRVNWNEI 210 The following BLAST results are available for this feature:
BLAST of TCONS_00007899 vs. Swiss-Prot (Human)
Analysis Date: 2017-10-03 (blastx Clytia hemisphaerica v1.0 mRNA vs SwissProt (Homo sapiens)) Total hits: 1
|