Overview
Sequence
The following sequences are available for this feature:
transcript sequence >TCONS_00010519 ID=TCONS_00010519|Name=TCONS_00010519|organism=Clytia hemisphaerica|type=transcript|length=390bpRun BLAST on NCBI protein sequence of TCONS_00010519-protein >TCONS_00010519-protein ID=TCONS_00010519-protein|Name=TCONS_00010519-protein|organism=Clytia hemisphaerica|type=polypeptide|length=107bp MEGIYNCSSSEKVLNLEKELEKELKDLQNEIEAGGVIGKTEHQSFSSVPIRun BLAST on NCBI transcript from alignment at sc0000107:275625..276554+ Legend: exonfive_prime_UTRCDS Hold the cursor over a type above to highlight its positions in the sequence below.>TCONS_00010519 ID=TCONS_00010519|Name=TCONS_00010519|organism=Clytia hemisphaerica|type=transcript|length=930bp|location=Sequence derived from alignment at sc0000107:275625..276554+ (Clytia hemisphaerica) Coding sequence (CDS) from alignment at sc0000107:275625..276554+ >TCONS_00010519 ID=TCONS_00010519|Name=TCONS_00010519|organism=Clytia hemisphaerica|type=CDS|length=321bp|location=Sequence derived from alignment at sc0000107:275625..276554+ (Clytia hemisphaerica) Gene-mRNA-Prot
This transcript is a part of the following gene feature(s):
Position
The following features are aligned
Expression
Hover the mouse over a column in the graph to view expression values in transcripts per million (tpm).
Values :
GrOo_1 GrOo_2 FGOo_1 FGOo_2 EG_1 EG_2 P1_1 P1_2 P2_1 P2_2 P3_1 P3_2 PoPr_1 PoPr_2 St_1 St_2 GO_1 GO_2 PH_1 PH_2 BMF_1 BMF_2 MMF_1 MMF_2 M_1 M_2 GEC_1 GEC_2 GEN_1 GEN_2 Annotated Terms
The following terms have been associated with this transcript:
Blast
BLAST of TCONS_00010519 vs. Swiss-Prot (Human)
Match: CF183 (Putative uncharacterized protein C6orf183 OS=Homo sapiens GN=C6orf183 PE=5 SV=3) HSP 1 Score: 80.8777 bits (198), Expect = 1.532e-18 Identity = 45/107 (42.06%), Postives = 80/107 (74.77%), Query Frame = 1 Query: 70 MEGIYNCSSSXXXXXXXXXXXXXXXXXQNEIEAGGVIGKTEHQSFSSVPIPNDAKFFRKQRKIAVKNCLKVREAKPLLLQSELMKEEVDSCLKSEYTNESIPVLLHQ 390 M+ IY +S+E+V LEK+L +L +L++EIE G + T ++ +SS+ +P D +FR++R++A+K L+V E+KPL++Q++ ++ E++SCL+ EYT E++P+LL Q Sbjct: 1 MDEIYKITSTERVQLLEKKLAVQLTELKSEIEEQGALQGTANRVYSSIQMPKDIYYFRRERELALKKTLQVAESKPLVVQADAVQRELESCLRREYTPENLPLLLLQ 107 The following BLAST results are available for this feature:
BLAST of TCONS_00010519 vs. Swiss-Prot (Human)
Analysis Date: 2017-10-03 (blastx Clytia hemisphaerica v1.0 mRNA vs SwissProt (Homo sapiens)) Total hits: 1
|