Overview
Sequence
The following sequences are available for this feature:
transcript sequence >TCONS_00020343 ID=TCONS_00020343|Name=TCONS_00020343|organism=Clytia hemisphaerica|type=transcript|length=249bpRun BLAST on NCBI transcript from alignment at sc0000354:46956..47593+ Legend: exon Hold the cursor over a type above to highlight its positions in the sequence below.>TCONS_00020343 ID=TCONS_00020343|Name=TCONS_00020343|organism=Clytia hemisphaerica|type=transcript|length=638bp|location=Sequence derived from alignment at sc0000354:46956..47593+ (Clytia hemisphaerica) Gene-mRNA-Prot
This transcript is a part of the following gene feature(s):
Position
The following features are aligned
Expression
Hover the mouse over a column in the graph to view expression values in transcripts per million (tpm).
Values :
GrOo_1 GrOo_2 FGOo_1 FGOo_2 EG_1 EG_2 P1_1 P1_2 P2_1 P2_2 P3_1 P3_2 PoPr_1 PoPr_2 St_1 St_2 GO_1 GO_2 PH_1 PH_2 BMF_1 BMF_2 MMF_1 MMF_2 M_1 M_2 GEC_1 GEC_2 GEN_1 GEN_2 Blast
BLAST of TCONS_00020343 vs. Swiss-Prot (Human)
Match: WDR63 (WD repeat-containing protein 63 OS=Homo sapiens GN=WDR63 PE=2 SV=1) HSP 1 Score: 109.768 bits (273), Expect = 8.637e-29 Identity = 48/82 (58.54%), Postives = 65/82 (79.27%), Query Frame = 3 Query: 3 ETGTPPYIFPIFFTSKTQEIFSCKADEDVKEENPHKIITKEQIQQDFKDRAAISDFHPAKKIVEEYPSDELLIVYDAAFQYG 248 E+ P I+P+ T+KTQEIF+C+ DEDV +E P+K+I KE I +D ++RAA+SDFHP KKIV+EYP +ELL+VYD F+YG Sbjct: 32 ESMGHPEIYPLVLTTKTQEIFNCRIDEDVTDEQPYKLINKEDIFEDLRNRAAVSDFHPVKKIVQEYPGNELLLVYDKDFKYG 113 The following BLAST results are available for this feature:
BLAST of TCONS_00020343 vs. Swiss-Prot (Human)
Analysis Date: 2017-10-03 (blastx Clytia hemisphaerica v1.0 mRNA vs SwissProt (Homo sapiens)) Total hits: 1
|