Overview
Sequence
The following sequences are available for this feature:
transcript sequence >TCONS_00020695 ID=TCONS_00020695|Name=TCONS_00020695|organism=Clytia hemisphaerica|type=transcript|length=244bpRun BLAST on NCBI transcript from alignment at sc0000363:161420..162237- Legend: exon Hold the cursor over a type above to highlight its positions in the sequence below.>TCONS_00020695 ID=TCONS_00020695|Name=TCONS_00020695|organism=Clytia hemisphaerica|type=transcript|length=818bp|location=Sequence derived from alignment at sc0000363:161420..162237- (Clytia hemisphaerica) Gene-mRNA-Prot
This transcript is a part of the following gene feature(s):
Position
The following features are aligned
Expression
Hover the mouse over a column in the graph to view expression values in transcripts per million (tpm).
Values :
GrOo_1 GrOo_2 FGOo_1 FGOo_2 EG_1 EG_2 P1_1 P1_2 P2_1 P2_2 P3_1 P3_2 PoPr_1 PoPr_2 St_1 St_2 GO_1 GO_2 PH_1 PH_2 BMF_1 BMF_2 MMF_1 MMF_2 M_1 M_2 GEC_1 GEC_2 GEN_1 GEN_2 Blast
BLAST of TCONS_00020695 vs. Swiss-Prot (Human)
Match: GALT7 (N-acetylgalactosaminyltransferase 7 OS=Homo sapiens GN=GALNT7 PE=1 SV=1) HSP 1 Score: 97.0561 bits (240), Expect = 1.611e-24 Identity = 48/80 (60.00%), Postives = 61/80 (76.25%), Query Frame = 3 Query: 3 SVIFIFHNEGWSTLLRSVHSVINRTPAQFLHEIVLVDDKSEMQHLHEPLDEELKKPFYQSKVKVVRNKEREGLIRARNNG 242 SV+ +FHNEGWSTL+R+VHSVI RTP ++L EIVL+DD S +HL E LDE +K + VKV RN+ REGLI+AR+ G Sbjct: 210 SVVIVFHNEGWSTLMRTVHSVIKRTPRKYLAEIVLIDDFSNKEHLKEKLDEYIK--LWNGLVKVFRNERREGLIQARSIG 287 The following BLAST results are available for this feature:
BLAST of TCONS_00020695 vs. Swiss-Prot (Human)
Analysis Date: 2017-10-03 (blastx Clytia hemisphaerica v1.0 mRNA vs SwissProt (Homo sapiens)) Total hits: 1
|