Overview
Sequence
The following sequences are available for this feature:
transcript sequence >TCONS_00021080 ID=TCONS_00021080|Name=TCONS_00021080|organism=Clytia hemisphaerica|type=transcript|length=495bpRun BLAST on NCBI transcript from alignment at sc0000377:235128..235901- Legend: exon Hold the cursor over a type above to highlight its positions in the sequence below.>TCONS_00021080 ID=TCONS_00021080|Name=TCONS_00021080|organism=Clytia hemisphaerica|type=transcript|length=774bp|location=Sequence derived from alignment at sc0000377:235128..235901- (Clytia hemisphaerica) Gene-mRNA-Prot
This transcript is a part of the following gene feature(s):
Position
The following features are aligned
Expression
Hover the mouse over a column in the graph to view expression values in transcripts per million (tpm).
Values :
GrOo_1 GrOo_2 FGOo_1 FGOo_2 EG_1 EG_2 P1_1 P1_2 P2_1 P2_2 P3_1 P3_2 PoPr_1 PoPr_2 St_1 St_2 GO_1 GO_2 PH_1 PH_2 BMF_1 BMF_2 MMF_1 MMF_2 M_1 M_2 GEC_1 GEC_2 GEN_1 GEN_2 Blast
BLAST of TCONS_00021080 vs. Swiss-Prot (Human)
Match: QSPP (Queuosine salvage protein OS=Homo sapiens GN=C9orf64 PE=1 SV=1) HSP 1 Score: 88.1965 bits (217), Expect = 4.267e-21 Identity = 44/111 (39.64%), Postives = 67/111 (60.36%), Query Frame = 2 Query: 107 MKQSLNPRDSGKYIAENTKYVQIQHKEIPKAALRLKEVMGRNKYSIKKWKEW-PLHPKAMNDDTLHWILTVDTLNFSFWLPRNEPQFQVEYKGKTYEDYEALCACVNRAVE 436 M LNPR+S K+IAEN++ V I + + A L + ++ WK L+P+A ++ ++W+ DTLNFSFW ++E + V Y+GKTY Y +LCA VNRA++ Sbjct: 1 MDGLLNPRESSKFIAENSRDVFIDSGGVRRVAELLLAKAAGPELRVEGWKALHELNPRAADEAAVNWVFVTDTLNFSFWSEQDEHKCVVRYRGKTYSGYWSLCAAVNRALD 111 The following BLAST results are available for this feature:
BLAST of TCONS_00021080 vs. Swiss-Prot (Human)
Analysis Date: 2017-10-03 (blastx Clytia hemisphaerica v1.0 mRNA vs SwissProt (Homo sapiens)) Total hits: 1
|