Overview
Sequence
The following sequences are available for this feature:
transcript sequence >TCONS_00026059 ID=TCONS_00026059|Name=TCONS_00026059|organism=Clytia hemisphaerica|type=transcript|length=234bpRun BLAST on NCBI transcript from alignment at sc0000560:124886..125247- Legend: exon Hold the cursor over a type above to highlight its positions in the sequence below.>TCONS_00026059 ID=TCONS_00026059|Name=TCONS_00026059|organism=Clytia hemisphaerica|type=transcript|length=362bp|location=Sequence derived from alignment at sc0000560:124886..125247- (Clytia hemisphaerica) Gene-mRNA-Prot
This transcript is a part of the following gene feature(s):
Position
The following features are aligned
Expression
Hover the mouse over a column in the graph to view expression values in transcripts per million (tpm).
Values :
GrOo_1 GrOo_2 FGOo_1 FGOo_2 EG_1 EG_2 P1_1 P1_2 P2_1 P2_2 P3_1 P3_2 PoPr_1 PoPr_2 St_1 St_2 GO_1 GO_2 PH_1 PH_2 BMF_1 BMF_2 MMF_1 MMF_2 M_1 M_2 GEC_1 GEC_2 GEN_1 GEN_2 Blast
BLAST of TCONS_00026059 vs. Swiss-Prot (Human)
Match: ACHB3 (Neuronal acetylcholine receptor subunit beta-3 OS=Homo sapiens GN=CHRNB3 PE=2 SV=2) HSP 1 Score: 76.6406 bits (187), Expect = 1.139e-17 Identity = 34/63 (53.97%), Postives = 43/63 (68.25%), Query Frame = -2 Query: 6 LTKKVIISSDGQVKWLSIAVLQSVCPMDVTYFPFDEQKCSLKFASWTHDGLKIDIVPENETVD 194 L KVI+ S+G V W A +S C MDVT+FPFD Q CS+KF SWT+DG +D++ NE VD Sbjct: 129 LMTKVIVKSNGTVVWTPPASYKSSCTMDVTFFPFDRQNCSMKFGSWTYDGTMVDLILINENVD 191 The following BLAST results are available for this feature:
BLAST of TCONS_00026059 vs. Swiss-Prot (Human)
Analysis Date: 2017-10-03 (blastx Clytia hemisphaerica v1.0 mRNA vs SwissProt (Homo sapiens)) Total hits: 1
|