Overview
Sequence
The following sequences are available for this feature:
transcript sequence >TCONS_00043297 ID=TCONS_00043297|Name=TCONS_00043297|organism=Clytia hemisphaerica|type=transcript|length=594bpRun BLAST on NCBI transcript from alignment at sc0004101:565..1158 Legend: exon Hold the cursor over a type above to highlight its positions in the sequence below.>TCONS_00043297 ID=TCONS_00043297|Name=TCONS_00043297|organism=Clytia hemisphaerica|type=transcript|length=594bp|location=Sequence derived from alignment at sc0004101:565..1158 (Clytia hemisphaerica) Gene-mRNA-Prot
This transcript is a part of the following gene feature(s):
Position
The following features are aligned
Expression
Hover the mouse over a column in the graph to view expression values in transcripts per million (tpm).
Values :
GrOo_1 GrOo_2 FGOo_1 FGOo_2 EG_1 EG_2 P1_1 P1_2 P2_1 P2_2 P3_1 P3_2 PoPr_1 PoPr_2 St_1 St_2 GO_1 GO_2 PH_1 PH_2 BMF_1 BMF_2 MMF_1 MMF_2 M_1 M_2 GEC_1 GEC_2 GEN_1 GEN_2 Blast
BLAST of TCONS_00043297 vs. Swiss-Prot (Human)
Match: AK1A1 (Alcohol dehydrogenase [NADP(+)] OS=Homo sapiens GN=AKR1A1 PE=1 SV=3) HSP 1 Score: 88.9669 bits (219), Expect = 4.729e-21 Identity = 39/64 (60.94%), Postives = 53/64 (82.81%), Query Frame = 3 Query: 315 IGSTVVPLYNGEKIPALGLGTWKSKPGEVGAAVEAAIDSGYRHIDCAAIYGNEKEVGEALKKKI 506 + ++ V L+ G+K+P +GLGTWKS+PG+V AAV+ A+ GYRHIDCAAIYGNE E+GEALK+ + Sbjct: 1 MAASCVLLHTGQKMPLIGLGTWKSEPGQVKAAVKYALSVGYRHIDCAAIYGNEPEIGEALKEDV 64 The following BLAST results are available for this feature:
BLAST of TCONS_00043297 vs. Swiss-Prot (Human)
Analysis Date: 2017-10-03 (blastx Clytia hemisphaerica v1.0 mRNA vs SwissProt (Homo sapiens)) Total hits: 1
|