Overview
Sequence
The following sequences are available for this feature:
transcript sequence >TCONS_00044491 ID=TCONS_00044491|Name=TCONS_00044491|organism=Clytia hemisphaerica|type=transcript|length=283bpRun BLAST on NCBI transcript from alignment at sc0005670:1..898+ Legend: exon Hold the cursor over a type above to highlight its positions in the sequence below.>TCONS_00044491 ID=TCONS_00044491|Name=TCONS_00044491|organism=Clytia hemisphaerica|type=transcript|length=898bp|location=Sequence derived from alignment at sc0005670:1..898+ (Clytia hemisphaerica) Gene-mRNA-Prot
This transcript is a part of the following gene feature(s):
Position
The following features are aligned
Expression
Hover the mouse over a column in the graph to view expression values in transcripts per million (tpm).
Values :
GrOo_1 GrOo_2 FGOo_1 FGOo_2 EG_1 EG_2 P1_1 P1_2 P2_1 P2_2 P3_1 P3_2 PoPr_1 PoPr_2 St_1 St_2 GO_1 GO_2 PH_1 PH_2 BMF_1 BMF_2 MMF_1 MMF_2 M_1 M_2 GEC_1 GEC_2 GEN_1 GEN_2 Blast
BLAST of TCONS_00044491 vs. Swiss-Prot (Human)
Match: HACE1 (E3 ubiquitin-protein ligase HACE1 OS=Homo sapiens GN=HACE1 PE=1 SV=2) HSP 1 Score: 75.0998 bits (183), Expect = 1.619e-16 Identity = 36/63 (57.14%), Postives = 44/63 (69.84%), Query Frame = 2 Query: 14 EFSLLLNGVCEIDVSDWQKNTRY-DGYCTSDDVIVWFWTLVHSLPQEEKSLLLKFVTGTPCLP 199 E LLL+G+ EIDVSDW KNT Y GY D VI WFW +V + QEE+ LLL+FVTG+ +P Sbjct: 780 ELELLLSGMPEIDVSDWIKNTEYTSGYEREDPVIQWFWEVVEDITQEERVLLLQFVTGSSRVP 842 The following BLAST results are available for this feature:
BLAST of TCONS_00044491 vs. Swiss-Prot (Human)
Analysis Date: 2017-10-03 (blastx Clytia hemisphaerica v1.0 mRNA vs SwissProt (Homo sapiens)) Total hits: 1
|