Overview
Sequence
The following sequences are available for this feature:
transcript sequence >TCONS_00045134 ID=TCONS_00045134|Name=TCONS_00045134|organism=Clytia hemisphaerica|type=transcript|length=316bpRun BLAST on NCBI transcript from alignment at sc0007034:641..956 Legend: exon Hold the cursor over a type above to highlight its positions in the sequence below.>TCONS_00045134 ID=TCONS_00045134|Name=TCONS_00045134|organism=Clytia hemisphaerica|type=transcript|length=316bp|location=Sequence derived from alignment at sc0007034:641..956 (Clytia hemisphaerica) Gene-mRNA-Prot
This transcript is a part of the following gene feature(s):
Position
The following features are aligned
Expression
Hover the mouse over a column in the graph to view expression values in transcripts per million (tpm).
Values :
GrOo_1 GrOo_2 FGOo_1 FGOo_2 EG_1 EG_2 P1_1 P1_2 P2_1 P2_2 P3_1 P3_2 PoPr_1 PoPr_2 St_1 St_2 GO_1 GO_2 PH_1 PH_2 BMF_1 BMF_2 MMF_1 MMF_2 M_1 M_2 GEC_1 GEC_2 GEN_1 GEN_2 Blast
BLAST of TCONS_00045134 vs. Swiss-Prot (Human)
Match: DYH6 (Dynein heavy chain 6, axonemal OS=Homo sapiens GN=DNAH6 PE=2 SV=3) HSP 1 Score: 88.1965 bits (217), Expect = 9.167e-21 Identity = 35/71 (49.30%), Postives = 50/71 (70.42%), Query Frame = -1 Query: 2 FFSFNRGLFEKAKLVFSFMICTDIMQQAGQISDNEWNYFLRGSSGVDVSYPTKPAVAWLTEHDWKICCSLE 214 + + +RGLFE+ KL++SFM+C ++M+Q G +SD EWN+FLRGS+G++ P KP WL W CC LE Sbjct: 3355 YVNVSRGLFEQHKLIYSFMLCVEMMRQQGTLSDAEWNFFLRGSAGLEKERPPKPEAPWLPTATWFACCDLE 3425 The following BLAST results are available for this feature:
BLAST of TCONS_00045134 vs. Swiss-Prot (Human)
Analysis Date: 2017-10-03 (blastx Clytia hemisphaerica v1.0 mRNA vs SwissProt (Homo sapiens)) Total hits: 1
|