Overview
Sequence
The following sequences are available for this feature:
transcript sequence >TCONS_00045209 ID=TCONS_00045209|Name=TCONS_00045209|organism=Clytia hemisphaerica|type=transcript|length=1090bpRun BLAST on NCBI transcript from alignment at sc0007194:5..1094 Legend: exon Hold the cursor over a type above to highlight its positions in the sequence below.>TCONS_00045209 ID=TCONS_00045209|Name=TCONS_00045209|organism=Clytia hemisphaerica|type=transcript|length=1090bp|location=Sequence derived from alignment at sc0007194:5..1094 (Clytia hemisphaerica) Gene-mRNA-Prot
This transcript is a part of the following gene feature(s):
Position
The following features are aligned
Expression
Hover the mouse over a column in the graph to view expression values in transcripts per million (tpm).
Values :
GrOo_1 GrOo_2 FGOo_1 FGOo_2 EG_1 EG_2 P1_1 P1_2 P2_1 P2_2 P3_1 P3_2 PoPr_1 PoPr_2 St_1 St_2 GO_1 GO_2 PH_1 PH_2 BMF_1 BMF_2 MMF_1 MMF_2 M_1 M_2 GEC_1 GEC_2 GEN_1 GEN_2 Blast
BLAST of TCONS_00045209 vs. Swiss-Prot (Human)
Match: SRC (Proto-oncogene tyrosine-protein kinase Src OS=Homo sapiens GN=SRC PE=1 SV=3) HSP 1 Score: 119.013 bits (297), Expect = 1.524e-29 Identity = 52/76 (68.42%), Postives = 59/76 (77.63%), Query Frame = 1 Query: 1 TEIVTKGRIPYPGMSNAETIAQVERGYRMPMPPNCPEPLYQIMLQCWNKEAENRPTFEYLQATMEDYFVSAEPSYR 228 TE+ TKGR+PYPGM N E + QVERGYRMP PP CPE L+ +M QCW KE E RPTFEYLQA +EDYF S EP Y+ Sbjct: 456 TELTTKGRVPYPGMVNREVLDQVERGYRMPCPPECPESLHDLMCQCWRKEPEERPTFEYLQAFLEDYFTSTEPQYQ 531 The following BLAST results are available for this feature:
BLAST of TCONS_00045209 vs. Swiss-Prot (Human)
Analysis Date: 2017-10-03 (blastx Clytia hemisphaerica v1.0 mRNA vs SwissProt (Homo sapiens)) Total hits: 1
|