Overview
Sequence
The following sequences are available for this feature:
transcript sequence >TCONS_00045322 ID=TCONS_00045322|Name=TCONS_00045322|organism=Clytia hemisphaerica|type=transcript|length=348bpRun BLAST on NCBI transcript from alignment at sc0007504:242..802+ Legend: exon Hold the cursor over a type above to highlight its positions in the sequence below.>TCONS_00045322 ID=TCONS_00045322|Name=TCONS_00045322|organism=Clytia hemisphaerica|type=transcript|length=561bp|location=Sequence derived from alignment at sc0007504:242..802+ (Clytia hemisphaerica) Gene-mRNA-Prot
This transcript is a part of the following gene feature(s):
Position
The following features are aligned
Expression
Hover the mouse over a column in the graph to view expression values in transcripts per million (tpm).
Values :
GrOo_1 GrOo_2 FGOo_1 FGOo_2 EG_1 EG_2 P1_1 P1_2 P2_1 P2_2 P3_1 P3_2 PoPr_1 PoPr_2 St_1 St_2 GO_1 GO_2 PH_1 PH_2 BMF_1 BMF_2 MMF_1 MMF_2 M_1 M_2 GEC_1 GEC_2 GEN_1 GEN_2 Blast
BLAST of TCONS_00045322 vs. Swiss-Prot (Human)
Match: IDH3A (Isocitrate dehydrogenase [NAD] subunit alpha, mitochondrial OS=Homo sapiens GN=IDH3A PE=1 SV=1) HSP 1 Score: 84.3445 bits (207), Expect = 3.273e-20 Identity = 41/66 (62.12%), Postives = 54/66 (81.82%), Query Frame = 3 Query: 6 QKVTLIPGDGIGPEISRSVERIFEAAQAPIEFEPVDVTPVVGLDGKTQIPAEAIESVNRNKIGLKG 203 Q VTLIPGDGIGPEIS +V +IF+AA+API++E +VT + G GK IP+EA ES+++NK+GLKG Sbjct: 32 QTVTLIPGDGIGPEISAAVMKIFDAAKAPIQWEERNVTAIQGPGGKWMIPSEAKESMDKNKMGLKG 97 The following BLAST results are available for this feature:
BLAST of TCONS_00045322 vs. Swiss-Prot (Human)
Analysis Date: 2017-10-03 (blastx Clytia hemisphaerica v1.0 mRNA vs SwissProt (Homo sapiens)) Total hits: 1
|