Overview
Sequence
The following sequences are available for this feature:
polypeptide sequence >TCONS_00045183-protein ID=TCONS_00045183-protein|Name=TCONS_00045183-protein|organism=Clytia hemisphaerica|type=polypeptide|length=99bpRun BLAST on NCBI Gene-mRNA-Prot
This polypeptide comes from the following gene feature:
Annotated Terms
The following terms have been associated with this polypeptide:
GO Annotation
GO Assignments
This polypeptide is annotated with the following GO terms.
InterPro
Analysis Name: InterPro Annotations of C. hemisphaerica v1.0
Date Performed: 2017-06-01
Blast
BLAST of TCONS_00045183-protein vs. Swiss-Prot (Human)
Match: CDK6 (Cyclin-dependent kinase 6 OS=Homo sapiens GN=CDK6 PE=1 SV=1) HSP 1 Score: 119.013 bits (297), Expect = 4.044e-34 Identity = 49/80 (61.25%), Postives = 68/80 (85.00%), Query Frame = 0 Query: 20 ESVLTIVFEHVDQDLSMFLQKYPAPALPEQLIKDLMYQMLSGLDYLHINRLIHRDIKPQNILITKNKQVKIADFGLARVY 99 E+ LT+VFEHVDQDL+ +L K P P +P + IKD+M+Q+L GLD+LH +R++HRD+KPQNIL+T + Q+K+ADFGLAR+Y Sbjct: 91 ETKLTLVFEHVDQDLTTYLDKVPEPGVPTETIKDMMFQLLRGLDFLHSHRVVHRDLKPQNILVTSSGQIKLADFGLARIY 170 The following BLAST results are available for this feature:
BLAST of TCONS_00045183-protein vs. Swiss-Prot (Human)
Analysis Date: 2018-01-31 (Blastp Clytia hemisphaerica v1.0 proteins vs SwissProt (Homo sapiens)) Total hits: 1
|