Overview
Sequence
The following sequences are available for this feature:
polypeptide sequence >TCONS_00007057-protein ID=TCONS_00007057-protein|Name=TCONS_00007057-protein|organism=Clytia hemisphaerica|type=polypeptide|length=359bpRun BLAST on NCBI Gene-mRNA-Prot
This polypeptide comes from the following gene feature:
InterPro
Analysis Name: InterPro Annotations of C. hemisphaerica v1.0
Date Performed: 2017-06-01
Blast
BLAST of TCONS_00007057-protein vs. Swiss-Prot (Human)
Match: NELFA (Negative elongation factor A OS=Homo sapiens GN=NELFA PE=1 SV=3) HSP 1 Score: 120.168 bits (300), Expect = 4.070e-30 Identity = 61/93 (65.59%), Postives = 70/93 (75.27%), Query Frame = 0 Query: 263 KKGLSLTREQMLAAQEMFRSANTVTRAEKALILGFMAGARENPFPQQGAVITIKLSE--EMIP----QGEQQVLVEMLFEMNYDTGHWRRLKR 349 KK LSLTREQM AAQEMF++AN VTR EKALILGFMAG+RENP +QG VI IKLSE E +P QG +LV+ +FEMNY TG W R K+ Sbjct: 428 KKNLSLTREQMFAAQEMFKTANKVTRPEKALILGFMAGSRENPCQEQGDVIQIKLSEHTEDLPKADGQGSTTMLVDTVFEMNYATGQWTRFKK 520 The following BLAST results are available for this feature:
BLAST of TCONS_00007057-protein vs. Swiss-Prot (Human)
Analysis Date: 2018-01-31 (Blastp Clytia hemisphaerica v1.0 proteins vs SwissProt (Homo sapiens)) Total hits: 1
|