Overview
Sequence
The following sequences are available for this feature:
polypeptide sequence >TCONS_00007423-protein ID=TCONS_00007423-protein|Name=TCONS_00007423-protein|organism=Clytia hemisphaerica|type=polypeptide|length=112bpRun BLAST on NCBI Gene-mRNA-Prot
This polypeptide comes from the following gene feature:
Annotated Terms
The following terms have been associated with this polypeptide:
InterPro
Analysis Name: InterPro Annotations of C. hemisphaerica v1.0
Date Performed: 2017-06-01
Blast
BLAST of TCONS_00007423-protein vs. Swiss-Prot (Human)
Match: BOLA3 (BolA-like protein 3 OS=Homo sapiens GN=BOLA3 PE=1 SV=1) HSP 1 Score: 94.3597 bits (233), Expect = 1.391e-26 Identity = 44/78 (56.41%), Postives = 58/78 (74.36%), Query Frame = 0 Query: 35 KSEGELHIENVLKSKMNVAD-IQVNDISGGCGSMYEVYVCSNDFKGKRMVQQHRLVTEILKSEVAEMHGLRIMTSVPE 111 ++EGEL + +LK K A I+V DISGGCG+MYE+ + S +FK KR VQQH++V + LK E+ EMHGLRI TSVP+ Sbjct: 29 QTEGELRVTQILKEKFPRATAIKVTDISGGCGAMYEIKIESEEFKEKRTVQQHQMVNQALKEEIKEMHGLRIFTSVPK 106 The following BLAST results are available for this feature:
BLAST of TCONS_00007423-protein vs. Swiss-Prot (Human)
Analysis Date: 2018-01-31 (Blastp Clytia hemisphaerica v1.0 proteins vs SwissProt (Homo sapiens)) Total hits: 1
|