Overview
Sequence
The following sequences are available for this feature:
polypeptide sequence >TCONS_00007657-protein ID=TCONS_00007657-protein|Name=TCONS_00007657-protein|organism=Clytia hemisphaerica|type=polypeptide|length=116bpRun BLAST on NCBI Gene-mRNA-Prot
This polypeptide comes from the following gene feature:
Annotated Terms
The following terms have been associated with this polypeptide:
GO Annotation
GO Assignments
This polypeptide is annotated with the following GO terms.
InterPro
Analysis Name: InterPro Annotations of C. hemisphaerica v1.0
Date Performed: 2017-06-01
Blast
BLAST of TCONS_00007657-protein vs. Swiss-Prot (Human)
Match: H2B1L (Histone H2B type 1-L OS=Homo sapiens GN=HIST1H2BL PE=1 SV=3) HSP 1 Score: 103.605 bits (257), Expect = 7.120e-30 Identity = 49/90 (54.44%), Postives = 68/90 (75.56%), Query Frame = 0 Query: 26 RKRKSRRRESYKNYIFKVLERNYPGQEISKSSLKVMNSFILDIFNGVANEASKLAHMNKSSTVTTYEIQEAVKLLLPGELAKTAIPMDSK 115 +KRK R+ESY Y++KVL++ +P IS ++ +MNSF+ DIF +A+EAS+LAH NK ST+T+ EIQ AV+LLLPGELAK A+ +K Sbjct: 28 KKRKRSRKESYSVYVYKVLKQVHPDTGISSKAMGIMNSFVNDIFERIASEASRLAHYNKRSTITSREIQTAVRLLLPGELAKHAVSEGTK 117 The following BLAST results are available for this feature:
BLAST of TCONS_00007657-protein vs. Swiss-Prot (Human)
Analysis Date: 2018-01-31 (Blastp Clytia hemisphaerica v1.0 proteins vs SwissProt (Homo sapiens)) Total hits: 1
|