Overview
Sequence
The following sequences are available for this feature:
polypeptide sequence >TCONS_00007660-protein ID=TCONS_00007660-protein|Name=TCONS_00007660-protein|organism=Clytia hemisphaerica|type=polypeptide|length=112bpRun BLAST on NCBI Gene-mRNA-Prot
This polypeptide comes from the following gene feature:
Annotated Terms
The following terms have been associated with this polypeptide:
GO Annotation
GO Assignments
This polypeptide is annotated with the following GO terms.
InterPro
Analysis Name: InterPro Annotations of C. hemisphaerica v1.0
Date Performed: 2017-06-01
Blast
BLAST of TCONS_00007660-protein vs. Swiss-Prot (Human)
Match: NDUA5 (NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 5 OS=Homo sapiens GN=NDUFA5 PE=1 SV=3) HSP 1 Score: 103.99 bits (258), Expect = 3.222e-30 Identity = 52/112 (46.43%), Postives = 72/112 (64.29%), Query Frame = 0 Query: 1 MAGYAKKATQLVGLAVAKAPRKTLTEIYSKTLGVLSTLPESSVYRQQVEHITNQRLELVKKTEDVMKLEKLINCGQIEEVMVQASDELQLVEQMAQWQVWEAPESQAPAGQW 112 MAG KK T LVGLAV P + L +Y+K L VL +P+++ YR+ E ITN++L +VK DV KLE + GQ+EEV++QA EL L +M +W++WE + PA QW Sbjct: 1 MAGVLKKTTGLVGLAVCNTPHERLRILYTKILDVLEEIPKNAAYRKYTEQITNEKLAMVKAEPDVKKLEDQLQGGQLEEVILQAEHELNLARKMREWKLWEPLVEEPPADQW 112 The following BLAST results are available for this feature:
BLAST of TCONS_00007660-protein vs. Swiss-Prot (Human)
Analysis Date: 2018-01-31 (Blastp Clytia hemisphaerica v1.0 proteins vs SwissProt (Homo sapiens)) Total hits: 1
|