Overview
Sequence
The following sequences are available for this feature:
polypeptide sequence >TCONS_00008474-protein ID=TCONS_00008474-protein|Name=TCONS_00008474-protein|organism=Clytia hemisphaerica|type=polypeptide|length=795bpRun BLAST on NCBI Gene-mRNA-Prot
This polypeptide comes from the following gene feature:
Annotated Terms
The following terms have been associated with this polypeptide:
GO Annotation
GO Assignments
This polypeptide is annotated with the following GO terms.
InterPro
Analysis Name: InterPro Annotations of C. hemisphaerica v1.0
Date Performed: 2017-06-01
Blast
BLAST of TCONS_00008474-protein vs. Swiss-Prot (Human)
Match: DOK1 (Docking protein 1 OS=Homo sapiens GN=DOK1 PE=1 SV=1) HSP 1 Score: 88.1965 bits (217), Expect = 3.569e-18 Identity = 43/103 (41.75%), Postives = 61/103 (59.22%), Query Frame = 0 Query: 248 SVASTVTEASSFPVTVRATIASQRSGMSGTYLLQVNPLNIVLIDVPTQ----KPVCEWPIQYLRRYGRGRTKFSFEASDKCKFGKGVYTFNTLEGDSIFHLVD 346 S+ S E S F VTV+ T A++R G+ G+Y+L+V + L+ V Q +P+ WP LRRYGR + FSFEA +C G G +TF T +G+ IF V+ Sbjct: 144 SLYSPTWEGSQFWVTVQRTEAAERCGLHGSYVLRVEAERLTLLTVGAQSQILEPLLSWPYTLLRRYGRDKVMFSFEAGRRCPSGPGTFTFQTAQGNDIFQAVE 246 The following BLAST results are available for this feature:
BLAST of TCONS_00008474-protein vs. Swiss-Prot (Human)
Analysis Date: 2018-01-31 (Blastp Clytia hemisphaerica v1.0 proteins vs SwissProt (Homo sapiens)) Total hits: 1
|