Overview
Sequence
The following sequences are available for this feature:
polypeptide sequence >TCONS_00010823-protein ID=TCONS_00010823-protein|Name=TCONS_00010823-protein|organism=Clytia hemisphaerica|type=polypeptide|length=319bpRun BLAST on NCBI Gene-mRNA-Prot
This polypeptide comes from the following gene feature:
Annotated Terms
The following terms have been associated with this polypeptide:
InterPro
Analysis Name: InterPro Annotations of C. hemisphaerica v1.0
Date Performed: 2017-06-01
Blast
BLAST of TCONS_00010823-protein vs. Swiss-Prot (Human)
Match: CBX8 (Chromobox protein homolog 8 OS=Homo sapiens GN=CBX8 PE=1 SV=3) HSP 1 Score: 79.337 bits (194), Expect = 1.265e-16 Identity = 37/66 (56.06%), Postives = 48/66 (72.73%), Query Frame = 0 Query: 11 VFAAEKILKKRYKKGRAEYLVKWQGYSSKFNTWEPVENILDERLLESYK------ALHPPGNRGKK 70 VFAAE +LK+R +KGR EYLVKW+G+S K++TWEP ENILD RLL +++ L+ P RG K Sbjct: 10 VFAAEALLKRRIRKGRMEYLVKWKGWSQKYSTWEPEENILDARLLAAFEEREREMELYGPKKRGPK 75 The following BLAST results are available for this feature:
BLAST of TCONS_00010823-protein vs. Swiss-Prot (Human)
Analysis Date: 2018-01-31 (Blastp Clytia hemisphaerica v1.0 proteins vs SwissProt (Homo sapiens)) Total hits: 1
|