Overview
Sequence
The following sequences are available for this feature:
polypeptide sequence >TCONS_00013465-protein ID=TCONS_00013465-protein|Name=TCONS_00013465-protein|organism=Clytia hemisphaerica|type=polypeptide|length=530bpRun BLAST on NCBI Gene-mRNA-Prot
This polypeptide comes from the following gene feature:
InterPro
Analysis Name: InterPro Annotations of C. hemisphaerica v1.0
Date Performed: 2017-06-01
Blast
BLAST of TCONS_00013465-protein vs. Swiss-Prot (Human)
Match: BD1L1 (Biorientation of chromosomes in cell division protein 1-like 1 OS=Homo sapiens GN=BOD1L1 PE=1 SV=2) HSP 1 Score: 89.7373 bits (221), Expect = 1.515e-18 Identity = 42/111 (37.84%), Postives = 73/111 (65.77%), Query Frame = 0 Query: 12 DPQITINDVVNNVKSEGIFDQFRKECIEEFENMESFNQLKQTVENHVASFLSKRRFSELLQKNLLRTELRNHLNKSEVLLNGIQRLVDEVLSLK-GHGFCLKIDKQVDQFL 121 DPQ+ + +VN++KS+G+FDQFR++C+ + + ++ L+Q V+N VA+ L+ +S L KN LR +R + KS +L +GI R++ +V+ K H F +++K V +FL Sbjct: 50 DPQL-VAMIVNHLKSQGLFDQFRRDCLADVDTKPAYQNLRQRVDNFVANHLATHTWSPHLNKNQLRNNIRQQVLKSGMLESGIDRIISQVVDPKINHTFRPQVEKAVHEFL 159 The following BLAST results are available for this feature:
BLAST of TCONS_00013465-protein vs. Swiss-Prot (Human)
Analysis Date: 2018-01-31 (Blastp Clytia hemisphaerica v1.0 proteins vs SwissProt (Homo sapiens)) Total hits: 1
|