Overview
Sequence
The following sequences are available for this feature:
polypeptide sequence >TCONS_00013962-protein ID=TCONS_00013962-protein|Name=TCONS_00013962-protein|organism=Clytia hemisphaerica|type=polypeptide|length=116bpRun BLAST on NCBI Gene-mRNA-Prot
This polypeptide comes from the following gene feature:
Annotated Terms
The following terms have been associated with this polypeptide:
GO Annotation
GO Assignments
This polypeptide is annotated with the following GO terms.
InterPro
Analysis Name: InterPro Annotations of C. hemisphaerica v1.0
Date Performed: 2017-06-01
Blast
BLAST of TCONS_00013962-protein vs. Swiss-Prot (Human)
Match: GLRX2 (Glutaredoxin-2, mitochondrial OS=Homo sapiens GN=GLRX2 PE=1 SV=1) HSP 1 Score: 86.6557 bits (213), Expect = 8.038e-23 Identity = 46/115 (40.00%), Postives = 68/115 (59.13%), Query Frame = 0 Query: 3 NTLTNTSTSST-HIDEKINTNCIVVYSTTVCGFCTKAKRLMDEMGLQYSVVEIDRLSPSEGGVVSRSLTEKTNMRTVPQIFINGNLIGGYSELIALQRTGNLLRRVAECDVNCSK 116 ++L N +T+ I E I+ NC+V++S T C +CT AK+L +M + Y VVE+D L G +L + T RTVP+IF+NG IGG ++ L + G LL V +C + SK Sbjct: 47 SSLENLATAPVNQIQETISDNCVVIFSKTSCSYCTMAKKLFHDMNVNYKVVELDLL--EYGNQFQDALYKMTGERTVPRIFVNGTFIGGATDTHRLHKEGKLLPLVHQCYLKKSK 159 The following BLAST results are available for this feature:
BLAST of TCONS_00013962-protein vs. Swiss-Prot (Human)
Analysis Date: 2018-01-31 (Blastp Clytia hemisphaerica v1.0 proteins vs SwissProt (Homo sapiens)) Total hits: 1
|