Overview
Sequence
The following sequences are available for this feature:
polypeptide sequence >TCONS_00019154-protein ID=TCONS_00019154-protein|Name=TCONS_00019154-protein|organism=Clytia hemisphaerica|type=polypeptide|length=681bpRun BLAST on NCBI Gene-mRNA-Prot
This polypeptide comes from the following gene feature:
Annotated Terms
The following terms have been associated with this polypeptide:
GO Annotation
GO Assignments
This polypeptide is annotated with the following GO terms.
InterPro
Analysis Name: InterPro Annotations of C. hemisphaerica v1.0
Date Performed: 2017-06-01
Blast
BLAST of TCONS_00019154-protein vs. Swiss-Prot (Human)
Match: SAV1 (Protein salvador homolog 1 OS=Homo sapiens GN=SAV1 PE=1 SV=2) HSP 1 Score: 86.6557 bits (213), Expect = 3.896e-18 Identity = 44/88 (50.00%), Postives = 58/88 (65.91%), Query Frame = 0 Query: 424 VPPSPYMSEEIPDWLQFYAKASPDHDEYLKWTMFRYTQLDCWQTMLKRLYKKELEQVVLWFEEYRSALSDELDRQEEIMHHQQQYQQQ 511 VP +PY + EIPDWLQ YA+A +D LKW +F+ LD +Q MLK L+ KELEQ+V +E YR AL EL+ +++ QQ Y QQ Sbjct: 294 VPANPYHTAEIPDWLQVYARAPVKYDHILKWELFQLADLDTYQGMLKLLFMKELEQIVKMYEAYRQALLTELENRKQ---RQQWYAQQ 378 The following BLAST results are available for this feature:
BLAST of TCONS_00019154-protein vs. Swiss-Prot (Human)
Analysis Date: 2018-01-31 (Blastp Clytia hemisphaerica v1.0 proteins vs SwissProt (Homo sapiens)) Total hits: 1
|