Overview
Sequence
The following sequences are available for this feature:
polypeptide sequence >TCONS_00019172-protein ID=TCONS_00019172-protein|Name=TCONS_00019172-protein|organism=Clytia hemisphaerica|type=polypeptide|length=302bpRun BLAST on NCBI Gene-mRNA-Prot
This polypeptide comes from the following gene feature:
Annotated Terms
The following terms have been associated with this polypeptide:
GO Annotation
GO Assignments
This polypeptide is annotated with the following GO terms.
InterPro
Analysis Name: InterPro Annotations of C. hemisphaerica v1.0
Date Performed: 2017-06-01
Blast
BLAST of TCONS_00019172-protein vs. Swiss-Prot (Human)
Match: VSX1 (Visual system homeobox 1 OS=Homo sapiens GN=VSX1 PE=1 SV=2) HSP 1 Score: 119.783 bits (299), Expect = 2.568e-31 Identity = 51/82 (62.20%), Postives = 62/82 (75.61%), Query Frame = 0 Query: 211 RRNRTIFTKKQASELERVFQTTHYPDLKCRHEISKVTKLSENRIQVWFQNRRAKWRRTEKTWGEGSVMAKYGLYGAMVRHSL 292 RR+RT+FT Q ELE+ F HYPD+ R ++ T+L E+RIQVWFQNRRAKWR+ EK WG SVMA+YGLYGAMVRH + Sbjct: 165 RRHRTVFTAHQLEELEKAFSEAHYPDVYAREMLAVKTELPEDRIQVWFQNRRAKWRKREKRWGGSSVMAEYGLYGAMVRHCI 246 The following BLAST results are available for this feature:
BLAST of TCONS_00019172-protein vs. Swiss-Prot (Human)
Analysis Date: 2018-01-31 (Blastp Clytia hemisphaerica v1.0 proteins vs SwissProt (Homo sapiens)) Total hits: 1
|