Overview
Sequence
The following sequences are available for this feature:
polypeptide sequence >TCONS_00022936-protein ID=TCONS_00022936-protein|Name=Paraxis|organism=Clytia hemisphaerica|type=polypeptide|length=317bpRun BLAST on NCBI Gene-mRNA-Prot
This polypeptide comes from the following gene feature:
Annotated Terms
The following terms have been associated with this polypeptide:
GO Annotation
GO Assignments
This polypeptide is annotated with the following GO terms.
InterPro
Analysis Name: InterPro Annotations of C. hemisphaerica v1.0
Date Performed: 2017-06-01
Blast
BLAST of Paraxis vs. Swiss-Prot (Human)
Match: TCF15 (Transcription factor 15 OS=Homo sapiens GN=TCF15 PE=2 SV=3) HSP 1 Score: 80.1073 bits (196), Expect = 6.128e-18 Identity = 44/97 (45.36%), Postives = 57/97 (58.76%), Query Frame = 0 Query: 220 RKTSTVRERTRTHNVNDGFVTLRNLIPTDPPDRKLSKIETLRLASSYIWHLNSILL---NSPQQTEAIHSHGTDLCYITCCMGTDR----ICTFCVS 309 R+ + RER RT +VN F LR LIPT+P DRKLSKIET+RLASSYI HL ++LL ++ + G+ + R ICTFC+S Sbjct: 74 RQAANARERDRTQSVNTAFTALRTLIPTEPVDRKLSKIETVRLASSYIAHLANVLLLGDSADDGQPCFRAAGSAKGAVPAAADGGRQPRSICTFCLS 170 The following BLAST results are available for this feature:
BLAST of Paraxis vs. Swiss-Prot (Human)
Analysis Date: 2018-01-31 (Blastp Clytia hemisphaerica v1.0 proteins vs SwissProt (Homo sapiens)) Total hits: 1
|