Overview
Sequence
The following sequences are available for this feature:
polypeptide sequence >TCONS_00027042-protein ID=TCONS_00027042-protein|Name=TCONS_00027042-protein|organism=Clytia hemisphaerica|type=polypeptide|length=138bpRun BLAST on NCBI Gene-mRNA-Prot
This polypeptide comes from the following gene feature:
Annotated Terms
The following terms have been associated with this polypeptide:
InterPro
Analysis Name: InterPro Annotations of C. hemisphaerica v1.0
Date Performed: 2017-06-01
Blast
BLAST of TCONS_00027042-protein vs. Swiss-Prot (Human)
Match: PR38A (Pre-mRNA-splicing factor 38A OS=Homo sapiens GN=PRPF38A PE=1 SV=1) HSP 1 Score: 82.8037 bits (203), Expect = 8.565e-20 Identity = 35/45 (77.78%), Postives = 43/45 (95.56%), Query Frame = 0 Query: 1 MDEFIDELLHEERSCDIILPRIQKRYLLEDSEQLEPRISALEDDL 45 +DEFIDELLH ER CDIILPR+QKRY+LE++EQLEPR+SALE+D+ Sbjct: 144 VDEFIDELLHSERVCDIILPRLQKRYVLEEAEQLEPRVSALEEDM 188 The following BLAST results are available for this feature:
BLAST of TCONS_00027042-protein vs. Swiss-Prot (Human)
Analysis Date: 2018-01-31 (Blastp Clytia hemisphaerica v1.0 proteins vs SwissProt (Homo sapiens)) Total hits: 1
|