Overview
Sequence
The following sequences are available for this feature:
polypeptide sequence >TCONS_00028423-protein ID=TCONS_00028423-protein|Name=TCONS_00028423-protein|organism=Clytia hemisphaerica|type=polypeptide|length=199bpRun BLAST on NCBI Gene-mRNA-Prot
This polypeptide comes from the following gene feature:
Annotated Terms
The following terms have been associated with this polypeptide:
InterPro
Analysis Name: InterPro Annotations of C. hemisphaerica v1.0
Date Performed: 2017-06-01
Blast
BLAST of TCONS_00028423-protein vs. Swiss-Prot (Human)
Match: RGS17 (Regulator of G-protein signaling 17 OS=Homo sapiens GN=RGS17 PE=1 SV=2) HSP 1 Score: 91.6633 bits (226), Expect = 4.514e-23 Identity = 45/124 (36.29%), Postives = 80/124 (64.52%), Query Frame = 0 Query: 78 EEARSWANNFERLLRHNVGQKVFQEFLQAQFSDENLRFWIEAEKYLNMTEEERMK----RAKSLYEDFVSSISPCEVSLDAYHRNQIEKEMDTAPKNLFKNAQDYIYCLMYRDCFXSKMHKIIY 197 EE SW+ NF+++++ G+ +F+EFL+ ++S+ENL FW+ E ++ +E+ K +A+ +YED++S +SP EVSLD+ R I + + +++++AQ IY LM+RD F ++ IY Sbjct: 76 EEVLSWSQNFDKMMKAPAGRNLFREFLRTEYSEENLLFWLACE---DLKKEQNKKVIEEKARMIYEDYISILSPKEVSLDSRVREVINRNLLDPNPHMYEDAQLQIYTLMHRDSFPRFLNSQIY 196 The following BLAST results are available for this feature:
BLAST of TCONS_00028423-protein vs. Swiss-Prot (Human)
Analysis Date: 2018-01-31 (Blastp Clytia hemisphaerica v1.0 proteins vs SwissProt (Homo sapiens)) Total hits: 1
|