Overview
Sequence
The following sequences are available for this feature:
polypeptide sequence >TCONS_00029095-protein ID=TCONS_00029095-protein|Name=TCONS_00029095-protein|organism=Clytia hemisphaerica|type=polypeptide|length=100bpRun BLAST on NCBI Gene-mRNA-Prot
This polypeptide comes from the following gene feature:
Annotated Terms
The following terms have been associated with this polypeptide:
GO Annotation
GO Assignments
This polypeptide is annotated with the following GO terms.
InterPro
Analysis Name: InterPro Annotations of C. hemisphaerica v1.0
Date Performed: 2017-06-01
Blast
BLAST of TCONS_00029095-protein vs. Swiss-Prot (Human)
Match: RL36 (60S ribosomal protein L36 OS=Homo sapiens GN=RPL36 PE=1 SV=3) HSP 1 Score: 125.561 bits (314), Expect = 5.120e-39 Identity = 59/87 (67.82%), Postives = 75/87 (86.21%), Query Frame = 0 Query: 6 ISVGLNKGHKVTKNAPKTKVSRTKGVLSKRVKFVRDVVQEVCGLAPYEKRAIELLKVNKDKRALKFVKKRLGTHTRGKRKRDELTRI 92 ++VGLNKGHKVTKN K + SR +G L+K KFVRD+++EVCG APYE+RA+ELLKV+KDKRALKF+KKR+GTH R KRKR+EL+ + Sbjct: 7 MAVGLNKGHKVTKNVSKPRHSRRRGRLTKHTKFVRDMIREVCGFAPYERRAMELLKVSKDKRALKFIKKRVGTHIRAKRKREELSNV 93 The following BLAST results are available for this feature:
BLAST of TCONS_00029095-protein vs. Swiss-Prot (Human)
Analysis Date: 2018-01-31 (Blastp Clytia hemisphaerica v1.0 proteins vs SwissProt (Homo sapiens)) Total hits: 1
|