Overview
Sequence
The following sequences are available for this feature:
polypeptide sequence >TCONS_00048558-protein ID=TCONS_00048558-protein|Name=TCONS_00048558-protein|organism=Clytia hemisphaerica|type=polypeptide|length=107bpRun BLAST on NCBI Gene-mRNA-Prot
This polypeptide comes from the following gene feature:
Annotated Terms
The following terms have been associated with this polypeptide:
GO Annotation
GO Assignments
This polypeptide is annotated with the following GO terms.
InterPro
Analysis Name: InterPro Annotations of C. hemisphaerica v1.0
Date Performed: 2017-06-01
Blast
BLAST of TCONS_00048558-protein vs. Swiss-Prot (Human)
Match: THIO (Thioredoxin OS=Homo sapiens GN=TXN PE=1 SV=3) HSP 1 Score: 91.2781 bits (225), Expect = 2.300e-25 Identity = 42/98 (42.86%), Postives = 64/98 (65.31%), Query Frame = 0 Query: 5 MVQEVKTMAEYQQIL--ADNKYVCVDYFATWCGPCRMIAPKIQEFEGKYGNVKFIKVDVDQATDIAEKEGISAMPTFKFFTNGERSGEVIGASEAKIK 100 MV+++++ +Q+ L A +K V VD+ ATWCGPC+MI P KY NV F++VDVD D+A + + MPTF+FF G++ GE GA++ K++ Sbjct: 1 MVKQIESKTAFQEALDAAGDKLVVVDFSATWCGPCKMIKPFFHSLSEKYSNVIFLEVDVDDCQDVASECEVKCMPTFQFFKKGQKVGEFSGANKEKLE 98 The following BLAST results are available for this feature:
BLAST of TCONS_00048558-protein vs. Swiss-Prot (Human)
Analysis Date: 2018-01-31 (Blastp Clytia hemisphaerica v1.0 proteins vs SwissProt (Homo sapiens)) Total hits: 1
|