Overview
Sequence
The following sequences are available for this feature:
polypeptide sequence >TCONS_00060958-protein ID=TCONS_00060958-protein|Name=TCONS_00060958-protein|organism=Clytia hemisphaerica|type=polypeptide|length=108bpRun BLAST on NCBI Gene-mRNA-Prot
This polypeptide comes from the following gene feature:
Annotated Terms
The following terms have been associated with this polypeptide:
InterPro
Analysis Name: InterPro Annotations of C. hemisphaerica v1.0
Date Performed: 2017-06-01
Blast
BLAST of TCONS_00060958-protein vs. Swiss-Prot (Human)
Match: STX18 (Syntaxin-18 OS=Homo sapiens GN=STX18 PE=1 SV=1) HSP 1 Score: 83.1889 bits (204), Expect = 2.726e-20 Identity = 46/116 (39.66%), Postives = 71/116 (61.21%), Query Frame = 0 Query: 1 MEITKVFKACVKAAKTRNKV----------DTTSDILPRSKKKKSDEVSFNSKAIEVVGGITKFKTFLVDCQSDYLDEFSH-LSFSSSMQDEERDQIDEDAQNFIKSCSTAIHKLK 105 ++IT +F+A VK KTRNK + ++ RS + K D F+S+A EV+ I K + FL++ + DY++ +SH +S M D ERDQID+DAQ F+++CS AI +L+ Sbjct: 3 VDITLLFRASVKTVKTRNKALGVAVGGGVDGSRDELFRRSPRPKGD---FSSRAREVISHIGKLRDFLLEHRKDYINAYSHTMSEYGRMTDTERDQIDQDAQIFMRTCSEAIQQLR 115 The following BLAST results are available for this feature:
BLAST of TCONS_00060958-protein vs. Swiss-Prot (Human)
Analysis Date: 2018-01-31 (Blastp Clytia hemisphaerica v1.0 proteins vs SwissProt (Homo sapiens)) Total hits: 1
|