Overview
Sequence
The following sequences are available for this feature:
polypeptide sequence >TCONS_00065193-protein ID=TCONS_00065193-protein|Name=TCONS_00065193-protein|organism=Clytia hemisphaerica|type=polypeptide|length=154bpRun BLAST on NCBI Gene-mRNA-Prot
This polypeptide comes from the following gene feature:
Annotated Terms
The following terms have been associated with this polypeptide:
InterPro
Analysis Name: InterPro Annotations of C. hemisphaerica v1.0
Date Performed: 2017-06-01
Blast
BLAST of TCONS_00065193-protein vs. Swiss-Prot (Human)
Match: MRC2 (C-type mannose receptor 2 OS=Homo sapiens GN=MRC2 PE=1 SV=2) HSP 1 Score: 80.1073 bits (196), Expect = 2.845e-18 Identity = 41/107 (38.32%), Postives = 58/107 (54.21%), Query Frame = 0 Query: 45 HQAKHACARFGGFLATINNQREHHFLVAKLQHYNIRSAWVGLNDKANEKVFRWDGSNVAGFKKWCPHEPNNFRYG-EDCVELLGPVNYKCLNDLPCTRVLPYICEVA 150 ++K AC R GG L +I++ E F+ +++ + W+GLND + F W ++ F W P EPNNFR EDCV + GP ND PC + LP IC+ A Sbjct: 404 QESKKACLRGGGDLVSIHSMAELEFITKQIKQ-EVEELWIGLNDLKLQMNFEWSDGSLVSFTHWHPFEPNNFRDSLEDCVTIWGPEGR--WNDSPCNQSLPSICKKA 507 The following BLAST results are available for this feature:
BLAST of TCONS_00065193-protein vs. Swiss-Prot (Human)
Analysis Date: 2018-01-31 (Blastp Clytia hemisphaerica v1.0 proteins vs SwissProt (Homo sapiens)) Total hits: 1
|