Overview
Sequence
The following sequences are available for this feature:
transcript sequence >TCONS_00022924 ID=TCONS_00022924|Name=TCONS_00022924|organism=Clytia hemisphaerica|type=transcript|length=730bpRun BLAST on NCBI transcript from alignment at sc0000436:245550..246334- Legend: exon Hold the cursor over a type above to highlight its positions in the sequence below.>TCONS_00022924 ID=TCONS_00022924|Name=TCONS_00022924|organism=Clytia hemisphaerica|type=transcript|length=785bp|location=Sequence derived from alignment at sc0000436:245550..246334- (Clytia hemisphaerica) Gene-mRNA-Prot
This transcript is a part of the following gene feature(s):
Position
The following features are aligned
Expression
Hover the mouse over a column in the graph to view expression values in transcripts per million (tpm).
Values :
GrOo_1 GrOo_2 FGOo_1 FGOo_2 EG_1 EG_2 P1_1 P1_2 P2_1 P2_2 P3_1 P3_2 PoPr_1 PoPr_2 St_1 St_2 GO_1 GO_2 PH_1 PH_2 BMF_1 BMF_2 MMF_1 MMF_2 M_1 M_2 GEC_1 GEC_2 GEN_1 GEN_2 Blast
BLAST of TCONS_00022924 vs. Swiss-Prot (Human)
Match: CB5D1 (Cytochrome b5 domain-containing protein 1 OS=Homo sapiens GN=CYB5D1 PE=2 SV=1) HSP 1 Score: 92.0485 bits (227), Expect = 5.158e-22 Identity = 44/79 (55.70%), Postives = 57/79 (72.15%), Query Frame = -1 Query: 347 HLLQVCSEENMREIQNRYFHYNKHAGSYTWKFNGQNLNMERTLQENNVKDESEDFYVLGMDEEQYLPALHLYFNDDLTE 583 H L+V E++ EI +RY YN HA SYTWK+ G+NLNM+ TL+EN ++DE E+F L MD + PA+ LYFNDDLTE Sbjct: 149 HTLEVGVLESIWEILHRYLPYNSHAASYTWKYEGKNLNMDFTLEENGIRDEEEEFDYLSMDGTLHTPAILLYFNDDLTE 227 The following BLAST results are available for this feature:
BLAST of TCONS_00022924 vs. Swiss-Prot (Human)
Analysis Date: 2017-10-03 (blastx Clytia hemisphaerica v1.0 mRNA vs SwissProt (Homo sapiens)) Total hits: 1
|