Overview
Sequence
The following sequences are available for this feature:
transcript sequence >TCONS_00045198 ID=TCONS_00045198|Name=TCONS_00045198|organism=Clytia hemisphaerica|type=transcript|length=978bpRun BLAST on NCBI transcript from alignment at sc0007178:129..1106 Legend: exon Hold the cursor over a type above to highlight its positions in the sequence below.>TCONS_00045198 ID=TCONS_00045198|Name=TCONS_00045198|organism=Clytia hemisphaerica|type=transcript|length=978bp|location=Sequence derived from alignment at sc0007178:129..1106 (Clytia hemisphaerica) Gene-mRNA-Prot
This transcript is a part of the following gene feature(s):
Position
The following features are aligned
Expression
Hover the mouse over a column in the graph to view expression values in transcripts per million (tpm).
Values :
GrOo_1 GrOo_2 FGOo_1 FGOo_2 EG_1 EG_2 P1_1 P1_2 P2_1 P2_2 P3_1 P3_2 PoPr_1 PoPr_2 St_1 St_2 GO_1 GO_2 PH_1 PH_2 BMF_1 BMF_2 MMF_1 MMF_2 M_1 M_2 GEC_1 GEC_2 GEN_1 GEN_2 Blast
BLAST of TCONS_00045198 vs. Swiss-Prot (Human)
Match: ARF6 (ADP-ribosylation factor 6 OS=Homo sapiens GN=ARF6 PE=1 SV=2) HSP 1 Score: 100.523 bits (249), Expect = 4.663e-25 Identity = 44/47 (93.62%), Postives = 47/47 (100.00%), Query Frame = -2 Query: 753 AMKPHEIQEKLGLTRIRDRNWFVQPSCATTGDGLYEGLTWLTANYKS 893 AMKPHEIQEKLGLTRIRDRNW+VQPSCAT+GDGLYEGLTWLT+NYKS Sbjct: 129 AMKPHEIQEKLGLTRIRDRNWYVQPSCATSGDGLYEGLTWLTSNYKS 175 The following BLAST results are available for this feature:
BLAST of TCONS_00045198 vs. Swiss-Prot (Human)
Analysis Date: 2017-10-03 (blastx Clytia hemisphaerica v1.0 mRNA vs SwissProt (Homo sapiens)) Total hits: 1
|